PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00397g01009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 259aa    MW: 29082.9 Da    PI: 6.6951
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00397g01009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.34.4e-18171205135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  Niben101Scf00397g01009.1 171 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 205
                               *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.0E-822253IPR016679Transcription factor, GATA, plant
Gene3DG3DSA:3.30.50.105.8E-14164202IPR013088Zinc finger, NHR/GATA-type
SMARTSM004016.5E-16165215IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.266165201IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-15166229No hitNo description
CDDcd002021.53E-13170217No hitNo description
PROSITE patternPS003440171196IPR000679Zinc finger, GATA-type
PfamPF003207.1E-16171205IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDVYGVSAPD LFRIDDLLDF SNDEIFSINS NSSSTTATPD SQHHHHQPHS DNSSAATANY  60
YNALLPNCSD DFTDNLCVPS DDVAELEWLS NFVEDSFSYF PTDSITGTMN LSSNTTASFH  120
GRSRSKRSRS TSSWTSSLQN PNTTTTMKNK EISVHTRERS SSMDDDVPRR CTHCASEKTP  180
QWRTGPLGPK TLCNACGVRF KSGRLVPEYR PAASPTFVLT QHSNSHRKVM ELRRQKEMIH  240
QQPPPTTEEG MYGHHFRVC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121126RSRSKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776947.11e-152PREDICTED: GATA transcription factor 4
RefseqXP_016447001.11e-152PREDICTED: GATA transcription factor 4-like
SwissprotO497416e-73GATA2_ARATH; GATA transcription factor 2
SwissprotO497433e-73GATA4_ARATH; GATA transcription factor 4
TrEMBLQ76DY11e-149Q76DY1_TOBAC; AG-motif binding protein-3
STRINGPGSC0003DMT4000669531e-145(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-62GATA transcription factor 4